SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SKV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SKV1
Domain Number 1 Region: 130-455
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.56e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 460-596
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.4e-23
Family Ricin B-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SKV1
Sequence length 603
Comment (tr|G3SKV1|G3SKV1_GORGO) Protein-UDP acetylgalactosaminyltransferase {ECO:0000256|RuleBase:RU361242} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GALNT9 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGALGDR
EAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDEGQEAEGKYEEYGYN
AQLSDRISLDRSIPDYRPRKCRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPS
QLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPV
VGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLWC
MYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRV
WQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM
TNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYCLDQ
GAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRMPTLKKC
EDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
ARH
Download sequence
Identical sequences G3SKV1
ENSGGOP00000028744 XP_018894700.1.27298 ENSGGOP00000028744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]