SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SL20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SL20
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily RUN domain-like 5.1e-33
Family RUN domain 0.0013
Further Details:      
 
Weak hits

Sequence:  G3SL20
Domain Number - Region: 215-257
Classification Level Classification E-value
Superfamily eIF1-like 0.0628
Family eIF1-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SL20
Sequence length 336
Comment (tr|G3SL20|G3SL20_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000000060} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLSKHELQ
RFYALRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRGRLSTFYEDWSFVMDEERSSM
LPTMAAAGLNSILFAINIDNKDLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLLR
EITASSAVSILIKSDQETDPLPVLSRNVSVDAKCKKERKKKKKVTNIISFDDEEDEQNSA
DVFPKIPAAGESSEDNSDRSSANIVTAFESSFGPNSNGSQSSSSWKIDSLSLNGEFGYQK
LDVKSIDDEDVDENEDDVYGNMPGRKCTGHSESPEK
Download sequence
Identical sequences G3SL20
ENSLAFP00000000060 ENSLAFP00000000060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]