SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SLU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SLU9
Domain Number 1 Region: 61-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-88
Family Calnexin/calreticulin 0.00000000246
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.3e-59
Family P-domain of calnexin/calreticulin 0.0000000312
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family Calnexin/calreticulin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SLU9
Sequence length 593
Comment (tr|G3SLU9|G3SLU9_LOXAF) Calnexin {ECO:0000313|Ensembl:ENSLAFP00000000430} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CANX OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEGKWLLCMLLVLGTAAVQAHDGHDDDMIDIEDDLDDVLEEVEDSKSKPDTSTPASPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLSDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPEGWLDNEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAVGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEE
RPWLWVVYTLTVALPVFLVILFCCSGKKQPSAVEYKKTDAPQPDVKEEEEEKEEEKHKED
EEEEGEEKLEEKQKSDAEEDGGTASQEEEDRKPKAEEDEILNRSPRNRKPRKE
Download sequence
Identical sequences G3SLU9
ENSLAFP00000021441 ENSLAFP00000000430 XP_003404750.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]