SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SLV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SLV9
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.53e-70
Family A middle domain of Talin 1 0.000000316
Further Details:      
 
Domain Number 2 Region: 2296-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.67e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1841-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-44
Family VBS domain 0.00000908
Further Details:      
 
Domain Number 4 Region: 1226-1362
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 5 Region: 767-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.67e-40
Family I/LWEQ domain 0.00000653
Further Details:      
 
Domain Number 6 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-31
Family Second domain of FERM 0.00000143
Further Details:      
 
Domain Number 7 Region: 661-783
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-30
Family I/LWEQ domain 0.0000654
Further Details:      
 
Domain Number 8 Region: 1075-1208
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.87e-28
Family VBS domain 0.011
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1470-1556
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000127
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000137
Family VBS domain 0.013
Further Details:      
 
Domain Number 12 Region: 81-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000106
Family Ubiquitin-related 0.09
Further Details:      
 
Domain Number 13 Region: 1697-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000314
Family VBS domain 0.047
Further Details:      
 
Domain Number 14 Region: 943-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000628
Family I/LWEQ domain 0.0029
Further Details:      
 
Weak hits

Sequence:  G3SLV9
Domain Number - Region: 1586-1660
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000345
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2108-2229
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0379
Family I/LWEQ domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SLV9
Sequence length 2542
Comment (tr|G3SLV9|G3SLV9_LOXAF) Talin 2 {ECO:0000313|Ensembl:ENSLAFP00000000440} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TLN2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGTVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETMEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVDHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKAK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVTV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAF
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVSQLACPALCKISVPHFGHLVSLSTLHSVRAIEVKVAESGLSFRFSAAASVVSQAL
PRLPAVRQFASRGEPIRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAM
RSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVA
TNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVAD
HIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLS
QCAKNLATSLAELRTASQKAIAHEACGPMEIDSALSTVQTLKNELQDAKMAAAESQLKPL
PGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKILAQAARGVA
ASTSDPSAAHAMLDSARDVMEGSAVLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNNC
VNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHA
TRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAA
KSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLDN
PNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGVASKALCGLTEA
AAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIVA
KHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCR
IATAPLIEAVENLTAFASNPEFVSVPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARS
LAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDISIDGINRCIRDIEQAS
LAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVTQLASYFE
PLVLAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKVQAQHTHDAIME
AAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGSPPEPKGTFVDYQTTGV
KYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAEPEEIGFQIRT
RVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLMLAALQAGQGTQACI
TAAFCVSGIIAELDTTIMFATAGTLNAENNETFADHRENILKTAKALVEDTKLLVSGAAS
TPEKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTV
FQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSEEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences G3SLV9
ENSLAFP00000000440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]