SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SMC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SMC7
Domain Number 1 Region: 64-339
Classification Level Classification E-value
Superfamily NHL repeat 1.36e-23
Family NHL repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SMC7
Sequence length 351
Comment (tr|G3SMC7|G3SMC7_LOXAF) NHL repeat containing 3 {ECO:0000313|Ensembl:ENSLAFP00000000653} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NHLRC3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MARFWVCVAGAGAGLFLTFLVLHSCFCGSPILRNFVFQISWTPENIRYRLDVGWPKYSEY
FSGTTFCVAVDSFNGLVYVAQQTGVNIPKVLVFTEDGYFLRAWNDTVDTPHGIFAASTPY
ERSVWITDVGSGSYGHTVKKYNSFGDLIQVLGTPGKKGTDLNPLQFDNPAELYVEDTGDI
YIVDGDGGLNNRLFKLSQDFMILWLHGENGTGPTQFNIPHSVTVDSAGRVWVADRGNKRI
QVFDKDTGEWLGAWDNCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSFVAAPPVGSIGSCS
VVSTLQLADQVLPHLLDVDRKTGAIYVAEIGARQVQKYVPLKSRFIPAFGE
Download sequence
Identical sequences G3SMC7
ENSLAFP00000000653 ENSLAFP00000000653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]