SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SME3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SME3
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-48
Family Galectin (animal S-lectin) 0.0000819
Further Details:      
 
Domain Number 2 Region: 187-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-46
Family Galectin (animal S-lectin) 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SME3
Sequence length 320
Comment (tr|G3SME3|G3SME3_LOXAF) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LOC100671480 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
VSTFSSLQSVPFQGTILGGLQDGLQIIIKGAVLSSSGSRFSVNFQTGSDEKDIAFHFNPR
FEEGGYVVCNTKQKGSWGPEERKMQMPFQKGQPFEICVLVQSPDFKVAVNGSHFLQYSHR
VPFHRADTISVQGALRLYSIEFQPPDIWSVNSAPIGQTIIHTMHSTPGWVFPNPTIPPMV
YSSPSPTYLVPYFTAIPGGLYPSKSIIVSGTILPNAQRFHINLRSGSDIAFHLNPRFNEN
TVVRNTQINSSWGSEERWLPGKMPFNRGQNFLVQILCESFCFRVAVNNQHLCEYNHRLKN
LPAINNLEVAGDIQLTHVQA
Download sequence
Identical sequences G3SME3
ENSLAFP00000000675 ENSLAFP00000000675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]