SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SMR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SMR5
Domain Number 1 Region: 26-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-33
Family Laminin G-like module 0.000000347
Further Details:      
 
Domain Number 2 Region: 210-385
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000317
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SMR5
Sequence length 395
Comment (tr|G3SMR5|G3SMR5_LOXAF) Sex hormone binding globulin {ECO:0000313|Ensembl:ENSLAFP00000000833} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SHBG OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SKVTSAPSFLKLLALVTNPHTQQGLAVPTQRPQDSPALHLCSGLGQEPVTVMTFDVTKIT
KTSSSFELQTWDPEGVIFYGDTNPNDDWFMLGLRDGGPEIQLHNHWAQLTVGTGPPLDDG
RWHQVEVKMDGDSVVLLVDGEEVLHLRQVSGPLARKPQPIMKIALGGLLFPSSNLRLPLV
PALDGCLRRDVWLDRRAQISASAPTSTRNCAVESQPGVFFPPGTHAEFSLQDIPQPHAET
WAFSLELGLQLAAGAGRLLALGTLANSPWLSLHFQDQKVVLSSGPGPGLDLPLVSGLPLQ
LKMDLSRVVLSQGLKEEVLALPPLGLDPLSNLWDQTQGYLFLGAVPGQASSSSFCLHDLW
AQGQRLDMDRALSRSQDIWTHSCPQSLGNGTDTSH
Download sequence
Identical sequences G3SMR5
ENSLAFP00000000833 ENSLAFP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]