SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SN44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SN44
Domain Number 1 Region: 117-358
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-70
Family Nuclear receptor ligand-binding domain 0.00000000144
Further Details:      
 
Domain Number 2 Region: 18-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-26
Family Nuclear receptor 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SN44
Sequence length 359
Comment (tr|G3SN44|G3SN44_LOXAF) Nuclear receptor subfamily 1 group I member 3 {ECO:0000313|Ensembl:ENSLAFP00000000995} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NR1I3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
CEATPTPETMVRGDDDPRNCVVCGDRATGYHFHALTCEGCKGFFRRTASKSTGLACSFDG
SCEVSKAQRRHCPACRLQKCLNAGMRKDSTVILSTEALALRRAKQAQRRAERTPVHLSKE
QKKLVQILLGAHTRHIGTVFDQFVRFRPPAHLFIHHQPLPTLAPELPLLRHFADISTFMV
QQVIKFTKDLPLFRSLPMEDQISLLKGAALEICHIALNTTFCLQTQNFLCGPLRYTMEDG
AQVGFQVEFLDSFFRFHGTLRRLQLQEPEYVLMAAMALFSPDRPGVTQREEIDQLQEEMA
LTLQSYIKGQQPMPRNRFLYAKLLGLLAELRSINDAYGYQIQHIQGLFAMMPLLQEICS
Download sequence
Identical sequences G3SN44
ENSLAFP00000000995 ENSLAFP00000000995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]