SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SN68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SN68
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-33
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 189-357
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-24
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SN68
Sequence length 379
Comment (tr|G3SN68|G3SN68_LOXAF) Pleckstrin homology and RhoGEF domain containing G7 {ECO:0000313|Ensembl:ENSLAFP00000001024} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PLEKHG7 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
KIFLNTLKYLQTHEYLLDVDLWRLFANLEELSQTSFGFVNSLFGIIKDYVDTPETAPSMD
FISVLTKYFRGSLCQSHQTYCLNYTAAVFYLENLRQRDDFGIYLKCCEQNEQCRRLHLPE
LLVAPLHRLTRYPLLLKNIWKRSTDSTEKVMIYSIKENVEKSIRDLEGKVKWLDNFQTLR
HLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTSRHLIYEGKLSLAESTRFLD
VYLFLFDDFLLVTKTKRNKKKSGNSDAGLMCPSLTAELQTVIKEGGSCTVVDQPIPLDRL
VVKNIDPLHVSVLGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMTQITAAISCFMK
SLETKKISLFTLPAESSEI
Download sequence
Identical sequences G3SN68
ENSLAFP00000001024 ENSLAFP00000001024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]