SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SN79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SN79
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily vWA-like 1.33e-75
Family Integrin A (or I) domain 0.00000057
Further Details:      
 
Domain Number 2 Region: 385-472
Classification Level Classification E-value
Superfamily Integrin domains 2.25e-21
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 590-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Integrin beta EGF-like domains 0.0064
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Weak hits

Sequence:  G3SN79
Domain Number - Region: 510-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00137
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SN79
Sequence length 767
Comment (tr|G3SN79|G3SN79_LOXAF) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGB8 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MCGWALTFFTVAFVCLQNCRRGPAQALRAAWVFSVVLGLGQSEDNRCADSNTASCAKCLA
LGPECGWCAQEVFVTGGSRSERCDIVSNLISKGCSVDSIEYPSVRVIPSGNEINTQVTPG
EVSIQLHPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMSLFS
LDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHMKNNVYVKSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGQIESKAANLNNLVVDAYQKLISEVKVQVENQVQGVYFNVTAICPDGSRKPGTDGCRN
VTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETTKIHIHRNCSCQCDDRREAKGKC
VDENFLDTNCFQCDDNKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGRCLCHKTKLGKV
YGKYCEKDDFSCPYYLGNLCAGHGECEAGRCQCHSGWEGDWCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPSCNTACNENWNCVQCLHPHNLSQAILDQCKSSC
ALMEHHSVDQTPECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWSSNKIKSSADY
RGPASKKDKLILHSVCTRAVTYRREKPEEIKIDISKLNAHETFRCNF
Download sequence
Identical sequences G3SN79
ENSLAFP00000001037 XP_003407135.1.64505 ENSLAFP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]