SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SPM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SPM0
Domain Number 1 Region: 388-605
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-55
Family DBL homology domain (DH-domain) 0.000098
Further Details:      
 
Domain Number 2 Region: 908-1166
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000275
Family WD40-repeat 0.05
Further Details:      
 
Domain Number 3 Region: 622-695,789-834
Classification Level Classification E-value
Superfamily PH domain-like 0.00000157
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SPM0
Sequence length 1356
Comment (tr|G3SPM0|G3SPM0_LOXAF) Rho guanine nucleotide exchange factor 10 {ECO:0000313|Ensembl:ENSLAFP00000001670} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ARHGEF10 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
KSQVDMEDPMPSLENEVKYDTNNNEEEEGEQFDFDSGDEIPEADRQTPSDPTASNAVANE
EASNTEPAAGENGPGTETMVLAEPAKLTVPTKVNPYSVIDITPFQEDQAPAPEPNAEEDG
LSLHVPSGYSIPVPCGYAVPSSLPLILPAYSSPVIIRTVSVDEEAETQEAAEDSQFNSFS
SEDPPNSEDQGNKEDSALARWVADPANTAWMENAEEAIYDDVPRENSDSEPDEMIYDDVE
NGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGTPRSFLRSNHKKQLSHDLTRLKEHYEK
KMKDLMANTVGAVEIQQLKQKHELKMQKLMKAAKEGTKDGLEKTKAAVKRGRSFIRTKSF
ISQDHRSCLEEEQNLFIDVDCKHPEAIMTPMPEGLSQQQVVRRYILGSIVDSEKNYVDAL
KRILEQYEKPLSEMEPKILSERKLKMVFYRVKEILQCHSMFQIALASRVSEWDSLEMIGD
VFVASFSKSMVLDAYSEYVNNFSTAVAILKKTCATKPAFLDFLKQCQESSPDRITLYSLM
MKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQ
IAKAINERYLNKLLSSGNRYLIRSDDMIETVYNDRGEIVKTKERRIFMLNDVLMCATVSA
RTSHESNAMISTSQRYLLKWSVPLGHVEVIEYGNNEGPGENSRYPPVHSLESLLVVANAK
PNKVYTGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQSIAHDWTSGLQRLILK
KEEEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKQSWINNLQMAKLALDIIT
EEENHMGWFCVEDDGNQIKKDKHPLLVRYMPVMVAKQQEFKIECAAYNPEPYLSNENQPD
SVSMAHGFLWIGSCTNQMGQIAIVSFQNSNPKVIECFNVESRILCMVYIPVEEKRKEPDE
ASDCETGAVRASGVPTICLGTEEGSIFIYKSSQGSKKVRLQHFFTPEKSTVMSLACTSQN
LYAGLVNGTVAIYTKAEDGSWNSEPQKVIKLGVLPVRSLLLMEDTLWAASGGQVFIISIE
THSIENQLEAHQEEGMVISHMAVAGVGIWIAFTSGSTLRLFHTETLKHLQDINIATPVHH
MLPGHQRVSVTSLLVCHGLLMVGTNLGIVVALPVPRLQGIPKVTGRGMVSYHAHNGPVKF
LVTATALHKKNKNKSRDSLPPSSEPQDEDQKDMLPSEALSSCLSHSNPDGAIWLGDPLGS
MTQKSDLSSSSGSLTLSHGSSSLEHKSEDSIIYDLLRDPNISLKSKAQRFKRAKACSVLV
VCGGQGHRRVNKKTRQQRPDELVSSVMVWQIPLLNI
Download sequence
Identical sequences G3SPM0
ENSLAFP00000001670 ENSLAFP00000001670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]