SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SPQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SPQ4
Domain Number 1 Region: 176-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000982
Family LDL receptor-like module 0.0045
Further Details:      
 
Weak hits

Sequence:  G3SPQ4
Domain Number - Region: 72-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000209
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SPQ4
Sequence length 287
Comment (tr|G3SPQ4|G3SPQ4_LOXAF) Low density lipoprotein receptor class A domain containing 2 {ECO:0000313|Ensembl:ENSLAFP00000001713} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LDLRAD2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MKVYLLQLPQRLLLLGAAAVTTSALETADLVNLCRQKWQGDGLLLCSHPASRKFYFMAQD
TDRGLWWWAEAPSNRVRFQLCFFLVYSMIPAFPVPLESLASNTSCPEWDPGAPGSYLQFY
KGPSGVPWPLGPPVCGLTIPAPVASSGPSMGLRLVTRGCQPRVNFVGEVTSFWLGFCGGY
FRRWNGRCIPPSLVCDRWDIDNCGDGSDRASQPPASCRVPPSLIHTLSPLPSLPPGSQRD
AAATRGSSITSSPALGSAGPLRTAAERTTPAGQDPALQGAASKGRQM
Download sequence
Identical sequences G3SPQ4
ENSLAFP00000001713 ENSLAFP00000001713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]