SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SQ19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SQ19
Domain Number 1 Region: 286-452,493-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-58
Family Tandem AAA-ATPase domain 0.00049
Further Details:      
 
Domain Number 2 Region: 58-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-38
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 3 Region: 4-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000557
Family Tandem AAA-ATPase domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SQ19
Sequence length 740
Comment (tr|G3SQ19|G3SQ19_LOXAF) DEAD-box helicase 1 {ECO:0000313|Ensembl:ENSLAFP00000001855} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=DDX1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
IFLFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKATIKTGGSVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGHIKFSKNGKDLGLAFEIPSHIKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKALESYVTKSQHTGSAQVAQTKFLPNAPKALIVEPSRELAE
QTLNNVKQFKKYVDNPKLRELLIIGGVAARDQLSVLDNGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRIHSQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKNHIRTDEVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
EVEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGNYKGHVDVLAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences G3SQ19
ENSLAFP00000001855 ENSLAFP00000001855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]