SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SQX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SQX7
Domain Number 1 Region: 628-798
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.16e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 63-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-39
Family DBL homology domain (DH-domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 282-351,409-443
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-20
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 4 Region: 488-594
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000848
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SQX7
Sequence length 844
Comment (tr|G3SQX7|G3SQX7_LOXAF) Active BCR-related {ECO:0000313|Ensembl:ENSLAFP00000002231} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ABR OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LVSDFSYGAEDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQSVGDSISPTPPE
GLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIE
TIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVNPLFLSEKMASQLGVYKAFVDNYKVALET
AEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHT
PVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSEGSRK
LRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHEL
EDMKMKISALKNEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSY
LFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDAR
TNESPGLYGFLHVIVHSAKKGKSNKYLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEF
EIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEM
NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRG
IEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTD
RLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHN
LATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYF
STDV
Download sequence
Identical sequences G3SQX7
ENSLAFP00000002231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]