SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SRF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SRF7
Domain Number 1 Region: 270-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000862
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 123-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 86-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SRF7
Sequence length 473
Comment (tr|G3SRF7|G3SRF7_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000002464} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SRPX OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
IGSGNLGPARFTLRGPLSLKEWPQKLLLCVLIAPLAWTMPIGSGDSPPEDDEAEYSHARY
KDTPWCSPIKVKYGNVHCRAPQGGYYKTALGTRCDVRCQKGYELHGSSQLICQSNKRWSD
KVICKQKRCPTLVMPANGGFKCVDGAYFNSQCEYYCSPGYTLKGERTVTCMDNKAWSGRP
ASCVDIEPPRIKCPSVKERIAEPNKLTIRVSWDTPEGRDTADGILTDVILKGLPPGSNFP
EGDHKIQYTVYDRAENKGTCKFRVKVRVKRCSKLNAPENGYMKCSSDGNNYGATCEFSCI
GGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAILLDQFYEKRRLLIVSAPTAR
NLLYRLQLGMLQQAQCGMDLRHITMVELVGVFPTLIGRIGTKIMPPALALQLRLLLRIPL
YSFSMVLVDKHGTDKERYNSLVTPMALFNLIDTFPLRKEEMVLQAEMGQTCSN
Download sequence
Identical sequences G3SRF7
ENSLAFP00000002464 ENSLAFP00000002464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]