SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SRM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SRM9
Domain Number 1 Region: 262-374
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.1e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00047
Further Details:      
 
Domain Number 2 Region: 1-59,202-247
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000244
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000431
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SRM9
Sequence length 442
Comment (tr|G3SRM9|G3SRM9_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000002557} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
GMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRP
PRATSACAPISSPKTNGLAKDMSSLHISPNSGHVTSASGPQMASGVSLVSFNSRPDGMHQ
RSYSVSSADQWSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHR
RKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILAS
LQSCESSKNKSRLTSQSEAMALQSIRNIRGNSHCVDCETQNPNWASLNLGALMCIECSGI
HRNLGTHLSRVRSLDLDDWPIELIKVMSSIGNELANSVWEESSQGRTKPSLDSTSEEKER
WIRAKYEQKLFLAPLPCLELSLGQHLLRATADEDLRTVILLLAHGSRDEVNETCGEGDGR
TALHLACRKGNVVLVQLLIWVG
Download sequence
Identical sequences G3SRM9
ENSLAFP00000002557 ENSLAFP00000002557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]