SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SS95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SS95
Domain Number 1 Region: 8-55
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000123
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 60-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SS95
Sequence length 192
Comment (tr|G3SS95|G3SS95_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000002810} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
CDSASSPINCQWDSYAPWSECDGCTKTQTRRRSIAVYGQYGGLPCVGSAFETQSCEPTRG
CPVEEGCGERFRCSSGQCISRSLVCNGDSDCEEDSSDEDRCEGSENRPSCDIDKPPPNVE
LTGNGYNALTGKFRNRVINTKSFGGQCRKVFSGDGRDFYRLSGNVLSYTFQVPNYIDCLK
TNLSFHDRFASF
Download sequence
Identical sequences G3SS95
ENSLAFP00000002810 ENSLAFP00000002810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]