SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SVD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SVD8
Domain Number 1 Region: 504-664
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-44
Family MAM domain 0.00046
Further Details:      
 
Domain Number 2 Region: 166-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-30
Family MAM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 338-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-29
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 23-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-20
Family MAM domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SVD8
Sequence length 686
Comment (tr|G3SVD8|G3SVD8_LOXAF) MAM domain containing 2 {ECO:0000313|Ensembl:ENSLAFP00000004201} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=MAMDC2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MLLRGVLLVLQALQLAGALNLPAGSCAFEENTCSFDSESAFLPWILNEEGHYIYVDTSFA
KQGEKAVLLSSDLQAEEWSCLRLVYQITTSSEPISDLSRLSLYVRFEDESFDRLLWSANK
ASDSWLIASLDLQNSTKKFKILIEGVLGQGNTASIALFEIKMTTGYCIECDFEENHLCGF
VNRWNPNVNWFVGGGSIRSSPSNLPQDHTFKSELGHYMYVDSVYVKHFQEVAQLISPMTT
APMSGCLSFYYQLQQGNDNAFYVYTRDMTGLYEEIWKTSSLGNAAWNLAEVEFSAPYPME
VIFEVAFNGPKGGYVALDDISFSPVRCQNQTELPFSAVEASCNFEENLCNFYQDKEGPGW
SRVKVKPNMYRVGDHTTGLGSYLLTNTKYTSQPGYIGRLYSPSLPGNLQYCLRFYYAIYG
FSKMSDTLAVYIFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMGLCKTFWD
CGLVALDDITIQLGNCWFPERLPPAPGECTFEQDECVFTQERRNRSSWHRRRGETPTSYT
GPKGDHTTGVGYYMYIEASNMVYGQKARLQSQPLRGVTGKHCLTFFYHMYGAGTGLLSVY
LKKEDNSEESLLWRRSGEQSISWLRALIEYSCERQHQIIFEAIRGVSIRSDIAIDDVKFQ
AGPCAELEDTTQQSSGYSEDLNEIEY
Download sequence
Identical sequences G3SVD8
ENSLAFP00000004201 XP_003407461.1.64505 ENSLAFP00000020548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]