SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SVI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SVI3
Domain Number 1 Region: 772-953
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-44
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 2 Region: 928-1049
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 156-190,229-375
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-30
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 14-155
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-20
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SVI3
Sequence length 1167
Comment (tr|G3SVI3|G3SVI3_LOXAF) TBC1 domain family member 1 {ECO:0000313|Ensembl:ENSLAFP00000004252} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TBC1D1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEPITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWIVAEVRRLSTSRKGPVTK
QVRLCVSPSGLRCEHEPGKSQQWDPLLCSSIFECKPQQVHKLIHNSHDPSYFACLIKEDV
ASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGRVT
VAHKKAPPALIDECIEKFNHISCSRKSEFDLLSQNSETPVGHEEQGRRPMRKSFSQPGLR
SLAFKKEFQDESLRSSRFFSSFEENDIESHLMSGHNVVQPTDIEENRTMLFTIGQSEVYL
ISPDTKKIAFEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDE
IMMTLKQAFTVAAVQRTSKAPAQLCEGCPVQCLHKLCERIEGMNTSKTKLELQKHLTTLT
NQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKDHVHIGEMKQTSQVAAENIGS
ELLPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGPPQEPSLSVDLDSSVSSTLSNT
SKEPSVCEKEALAVSESSFKLLSSSDDLSSDSESHLSEEAAQLSPQQGFRRRANTLSHLP
TESQELPEPAEVSPGVSQRKLMRYHSVSTETPHERKDFETKTNHPGDASGTPVKTRRHSW
RQQIFLRVATPQKACDSPSRYEDYPDLGELPPRSPLEPVCEDGSSGLVPEEKKRTSRELR
ELWQKAILQQILLLRMEKENQKLQASESDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTP
GRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQYHLRHQFPSKQQPKDTPYKELLKQL
TSHQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILL
LHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIG
PSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVVFKVALSLLGSHKPLILQHENLET
IVDFIKNTLPNLGLVQMEKTINQVFEMDISKQLQAYEVEYHVLQEELIDSSPLSDNQRMD
KLEKTNSSLRKQNLDLLEQLQVANSRIQSLEATVEKLLTSENKLKQATLALELERSALLQ
TVEELRRQTAGLSRTEPAPADPEPAGD
Download sequence
Identical sequences G3SVI3
ENSLAFP00000004252 ENSLAFP00000004252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]