SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SVP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SVP3
Domain Number 1 Region: 120-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-40
Family Galectin (animal S-lectin) 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SVP3
Sequence length 250
Comment (tr|G3SVP3|G3SVP3_LOXAF) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LGALS3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MADSFSLNDALSGPRNPNPQGWPGSWGNQPAGPGGYPGASYPGAYPGQGPPGAYPGQGPP
GAYPGQGPPGAAYPGPPAPGAYPSGPGPYPPPGQPPAPGAYPAANPFGSSAGPLAVTYDF
PFQEESCLAMLITILGTVKPNANRIALDFKRGNDVAFHFNPRFNENNRRVIVCNTKHDNV
WGREERQNVFPFESGKPFKIQVLAESDHFKVAVNDAHLLQYNHRMRNLREINKLGISGDI
ILTSASHAMM
Download sequence
Identical sequences G3SVP3
ENSLAFP00000004321 ENSLAFP00000004321 XP_003408709.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]