SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SWU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SWU7
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000034
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000887
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000463
Family I set domains 0.05
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000265
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SWU7
Sequence length 847
Comment (tr|G3SWU7|G3SWU7_LOXAF) Follistatin like 5 {ECO:0000313|Ensembl:ENSLAFP00000004827} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FSTL5 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MFKCWSAVLVLGFIFLESEGRPPKEAGYVLKSYQPLVRLRHKQEKSQESSRTKGFLIQDG
PFGSCENKYCGLGRHCVISRELGRAECACMELCKRHYKPVCGSDGQFYENHCEVHRAACL
KKQKITIVHNEDCFFRGDRCETAEYSKMKNMLLDLQNQKYITQENENPNSDAIARKKILV
DQMFKYFDADNNGLVDINELTQVIKQEEFSKDLSDCTLYDLLKYEDFNSDKHLALEEFYR
AFQVIQLSLPEDQKVSVTAATVGQSAVLSCAIQGALRPPVIWKRNSIILNNLDLEDINDF
GDDGSLYITKVTTTHMGNYTCYAEGYEYVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPNPQLSWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQEEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTMDKTSPTLEVITLAGGNVAHHTIHTQPVGKQFDRVDD
FFIPTTTLLITHMRFGFILHKDEAALQKIDLETMSYMKTINLKDYQCIPQSLAYTHLGGY
YFIGCKPDSTGAIPPQLVVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDMKGIVRVQY
ITIRGEIQEAFDIHTNLHISDVAFQPSFTEANQYNIYGSSSMQTDVLFVELASGKVKMIK
SLKEPLKAEDWLWNRKNRQIQDSGLFGQYLMTPSKNSLFILDGRLNKLNCEITEVEKGNT
IIWVGDA
Download sequence
Identical sequences G3SWU7
ENSLAFP00000004827 XP_003418537.1.64505 ENSLAFP00000004827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]