SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SX18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SX18
Domain Number 1 Region: 870-1080
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-54
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1069-1189
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-25
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 1243-1431
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-23
Family Pleckstrin-homology domain (PH domain) 0.00000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SX18
Sequence length 1435
Comment (tr|G3SX18|G3SX18_LOXAF) FYVE, RhoGEF and PH domain containing 6 {ECO:0000313|Ensembl:ENSLAFP00000004918} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FGD6 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
FFSFLEIKKPPVAPKPKFVMANNKPAPPPVAPKPDIVISSAPQSIKKTKPAIAPKPKVLK
DSPVRDISLSPSRTMNLEEHKQKVPENADDFNSKNVGNQSSDYILPACPCSSECSHKLGN
RGNSCVKQLVLEPLEMHENLENCKIDEFSLTVKTRDKCDSHGKKVKSQSGVVLKASILEE
NLKDVLTQGTSPFSSPPKHRSKDNPDVNGGCNSNKQFSIEFTDLSPSSSSFEKVSDHHHL
LQPPSDEFQIVETCQDSIRKSSSCFHSSKQLALENGKRNNFISSDEVSKKMEVKDVGPLE
IHLVPYTKKFPTPKPRKTRTACLIRQRYVDTPSESTEEPENSDSSSSCLIEDNLRNNKIS
VLPQNVLCNQQQVDKVKRGSKNELNLDSDYDREDLANSQKAVCPETFSFEKMASPLDTDS
SLSSDSKTVDGCNMSLAMDNGISITGCSALSVSLPKQLKLTSNEHLPAAYNPGVCAYQMQ
KESTIKDESSLRIIPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEEKNSEKSLERNHV
QHLCAQNHGMSSSFDVPKRASEKPVWKLPHPILPFSGNPESLKSVRMSSNSEPLGALTKP
RARSLSAVDVERSTKPCKDSQKKNSLKKLLNAKLSTCFMKGDFQKFWSKSSQLEDTTTGN
LCGGEQKGIESDWHGLLAGEEKRSKPIKAYSADNYSLESQKKRKKSRGQTSMASSPRAES
LDDQMLSRESSSQAPCRSVTSACAPEYENIHHYKETPAYENLPFIMVIGKTPEFECRNSS
NMEDTDANVYEVEDPYEAPASQLQLGSRLQHCRNSSGASQEGHNDLDLGLDDLPSDEEEV
INSSDEDDVSSGSSKGEPDPLEDKQGEDTGMKCKVHHIAKEIMSSEKVFVDVLKLLHIDF
RDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKEMEERMLNWTEQQRIADIFV
KKGPYLKMYSTYIKEFDKNIALLDEQCKKNPSFAAVVRDFEMSPRCANLALKHYLLKPVQ
RIPQYRLLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSL
NGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMFKLNNMLSLAG
MKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISKSIEEYAKKRITFCPSRS
LDEADSENKEEVSPLGSKAPIWIPDTRVTMCMICTSEFTLTWRRHHCRACGKIVCQACSS
NKYGLDYLKNQPARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSALSSVLHSIPSGRKQ
KKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQ
PLLGFTVTQVKDENSESKVFQLLHKNMLFYVFKAEDAHSAQNNRWIEAFQEGTIL
Download sequence
Identical sequences G3SX18
ENSLAFP00000004918 ENSLAFP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]