SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SY33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SY33
Domain Number 1 Region: 66-207
Classification Level Classification E-value
Superfamily L domain-like 3.21e-35
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Weak hits

Sequence:  G3SY33
Domain Number - Region: 331-548
Classification Level Classification E-value
Superfamily NHL repeat 0.000732
Family NHL repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SY33
Sequence length 557
Comment (tr|G3SY33|G3SY33_LOXAF) Leucine rich glioma inactivated 1 {ECO:0000313|Ensembl:ENSLAFP00000005365} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LGI1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEAERSQRMGNACVPLKRIAYFLCLLSALLLTEGKKPTKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLDHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
QLFGGSHIYKRDGFANKFIKIQDIEILKIRKPNDIETFNIENNWYFVVADSSKAGFTTIY
KWNGNGFYSHQSLHAWYRDTDVEYLEIARTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGASFQDIQRMPSRGSMVFQ
PLQINNYQYAILGSDYSFTQVYNWDADKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
FKGNTQIYKHVIVDLSA
Download sequence
Identical sequences G3SY33
XP_003409275.1.64505 ENSLAFP00000005365 ENSLAFP00000005365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]