SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SYI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SYI3
Domain Number 1 Region: 41-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-71
Family Lectin leg-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SYI3
Sequence length 351
Comment (tr|G3SYI3|G3SYI3_LOXAF) Lectin, mannose binding 2 like {ECO:0000313|Ensembl:ENSLAFP00000005566} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LMAN2L OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
GWWQRWGPGLAARDGSKMLLLLLFLGSGQGPRHAGAGQTFEYLKREHSLSKPYQGVGTGS
SPLWNLLGSAMVMTQCIRLTPDVQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGD
GLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQETQKRRYSPGVQRVFPYVSA
MVNNGSLSYDHERDGRPTELGGCTAIVRNLNHDTFLVIRYVKRHLTIMMDIDGKHEWRDC
IEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNM
KLPEMTAPLPPLSGLALFLIVFFSLVFSVFAVVIGIILYTKWQEQSRKRFY
Download sequence
Identical sequences G3SYI3
ENSLAFP00000028661 ENSLAFP00000005566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]