SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T050 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T050
Domain Number 1 Region: 280-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-44
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 2.14e-18
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000931
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T050
Sequence length 451
Comment (tr|G3T050|G3T050_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000006312} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LOC100669982 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
FFPRKMDSAFQKELTCFICLKYLTDPVTIGCGHSFCQACVCLSWEEAKIPARCPICRNTS
EQTEFRTNTLLKNLVSLARQASLCQFLSSEEQMCGTHKETKKMFCEESKNLLCLLCSNSQ
EHEAHSHCSIECAVEEYREKLIKEMRSLWKNIQKNQRNLNEESKITNLWRYYVCLLSEII
SSEYQKLHPILLEEEKQHLEGLKNEGKKILQQLKKSEATMVQKGRHLREMYEELMNMCHK
SDVELLQDLGDILTRSESVQLDMPQPVNPALSARPITGLIDRFRQFRVEISFRYEISSQN
IMVFDDVRSLRLRRDLQEVPFPSRRSQYFAAWGDQAFTSGKHYWEIDVDDSWDWAVGVCK
DTWLRKNGSLVESENVFLLLCVKDVNRYNLLTTSPVFPQYIEKPLGRVGVYIDFDSRSMS
FVNVAKSSLIWRYPACSFNYPLRPFFCTGHT
Download sequence
Identical sequences G3T050
ENSLAFP00000006312 ENSLAFP00000006312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]