SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T0F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T0F3
Domain Number 1 Region: 63-128
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.93e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 256-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000838
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 164-221
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000036
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T0F3
Sequence length 366
Comment (tr|G3T0F3|G3T0F3_LOXAF) Transmembrane protein with EGF like and two follistatin like domains 1 {ECO:0000313|Ensembl:ENSLAFP00000006443} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TMEFF1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RLPAAPPLAFCCYTSMLLLFAFSLPGSRASNQPPGGGSSGAGSGGFSSFTELNVRESDVR
VCDESSCKYGGVCKEDGDGLKCACQFQCHTNYVPVCGSNGDTYQNECFLRRAACKHQREI
TVVARGPCYSDNGSGSGEGAEEEGSGTEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDC
SGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYR
PDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTD
FSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFPSD
TSSRMV
Download sequence
Identical sequences G3T0F3
ENSLAFP00000022647 ENSLAFP00000006443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]