SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T0X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T0X1
Domain Number 1 Region: 76-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.41e-16
Family Complement control module/SCR domain 0.00034
Further Details:      
 
Domain Number 2 Region: 138-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.32e-16
Family Complement control module/SCR domain 0.00028
Further Details:      
 
Domain Number 3 Region: 199-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000681
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 446-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 5 Region: 15-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000197
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 392-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000216
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 263-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000629
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T0X1
Sequence length 556
Comment (tr|G3T0X1|G3T0X1_LOXAF) Complement component 4 binding protein alpha {ECO:0000313|Ensembl:ENSLAFP00000006663} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=C4BPA OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
IILVAALLASVLGDCGPPPNLLFASPMYEVKEENFSTGTILKYTCRPGYSKAISSQTVTC
DDGGSWSYKTFCTKKRCRNPGDLPNGHVEVKTDFYFGSQIEFSCLEGYILLGSTTSFCDI
QDKGVDWSDPLPLCVIANCMPPPSISNGKHNGGEEDVYTYGSSVTYSCDPHFSLLGKASI
SCMVENKTIGVWSPSPPTCKKITCFPPEVPNGTIISGFGPTYTYKDSIVYNCKDGFILRG
NSVVHCGDDNDWHPSPPVCELNSCINLPDIPHASWETRYNYRPRKDNMYSIGTVLRYHCN
AGYRPISNEPTTVMCQEDLTWTPYKGCETAKVPTKNGLGIASPSLYASSVIPDVQFNFHF
SCSADHIESKMSCFINSGSSSSLTFLSHHQGCHFPPSIAHGRYKRIYFYGKTEFMYECDT
GYTLVGQAKFSCSSSALSPPAPQCKALCLKPHIQNGKLLVHKEEYTEGENVIVQCNPGYR
LVGSQNITCSENRSWYPEVPKCEWEVPEGCERVLAGRNLMQCLPSPQDVKMALELYKLSL
EIEQLEREGQRTHSGA
Download sequence
Identical sequences G3T0X1
ENSLAFP00000006663 ENSLAFP00000006663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]