SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T1A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T1A8
Domain Number 1 Region: 321-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-68
Family SPRY domain 0.00000233
Further Details:      
 
Domain Number 2 Region: 36-140
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-18
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 
Domain Number 3 Region: 156-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000177
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T1A8
Sequence length 561
Comment (tr|G3T1A8|G3T1A8_LOXAF) Erythroblast membrane associated protein (Scianna blood group) {ECO:0000313|Ensembl:ENSLAFP00000006839} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ERMAP OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LEMASFSGSWLSGCLITLIFLQLPAPGSGDARKFHLVPLGGTAELLCPLPLWPGMEPTEV
RWLRSPHPQLSQAVHVFRNGKDWDDGQMPEYKGRTVLVRDTQEGNVTLKILNVRLEDQGQ
YRCQIQIGNLSKEGSVTLQVAVLGSDPDIHVEGYDAGWIKVVCRSVGWFPKPSAEWRDPQ
GTVLPSLSEVHDLDEAGLFQTTVSSRVRDSTLGNVFCIIHNSALGLEKKAVMVIAAPSPG
RISSPTVALVVMLPVLGLLFIAGIFLIRKQRRSKEKLLYEQAMEVENLLSDHAEEKGRLH
KALKKLRSELKLKRAAANAGWRRAQLHFVAVTLDPDTAHPKLILSGDRRCVRLGDRKQPV
PDNPQRFDFVVSVLGSECFTAGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPSNGHW
LVRQSRENHYEALTSPQTSFRLKEPPLYVGIFLDYEAGIISFFNVTDKSHIFTFTHSFSG
PLRPFFEPCLHDGGKNLAPLVICSELHRSEESTVPRPERKSHANGDVSLKVDPSLFPPPS
EELFPLKDLSPALQGLKVPSF
Download sequence
Identical sequences G3T1A8
ENSLAFP00000006839 ENSLAFP00000006839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]