SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T245 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T245
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000219
Family EGF-type module 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T245
Sequence length 208
Comment (tr|G3T245|G3T245_LOXAF) Heparin binding EGF like growth factor {ECO:0000313|Ensembl:ENSLAFP00000007213} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=HBEGF OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MKLLPSVVLKLLLATVLSALVTGESLERIRRGVAAGTRKPDPPTGSTDQLLPSGDARSRE
VLDLDEANLDLFRVAFSSKPQAQATPSKEEYGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CRYVKKLRAPSCLCQPGYHGERCHGLTLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYNVENEEKVKLGMTNSH
Download sequence
Identical sequences G3T245
ENSLAFP00000007213 ENSLAFP00000007213 XP_003404583.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]