SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T252 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T252
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 410-447,476-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000068
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000227
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T252
Sequence length 647
Comment (tr|G3T252|G3T252_LOXAF) Zinc finger protein 202 {ECO:0000313|Ensembl:ENSLAFP00000007221} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ZNF202 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCGSESILQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEESVHLGAVPESPSELQDPVQTSTPKESHEETTQ
SPDLGALEEQSPGSEEEFQPLQESEAHVLHDPGLPEERNTRDPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPAQKEFHGEYVLEEDCGIVVSLSFPIPRLDEISQVREEESWVPDI
QEPQEPQETEILSFTYTGDQSEDEEDYLEQEDLSLEDLQRSILGDPEIHQTPDWEIVLED
NPGRLNESGFGTSTSQVNSFTNLQETMPLHPLLGRHHDCPVCGKSFTCNSHLVRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKIHKMGTSYKFPLNRKNVDETSPLIQAERTPPIEKP
YRCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYSCG
ECGEDFHDHRRYLAHQKTHAAEELYLCSECGRCFNHSSAFAKHLRGHASVRPCRCNECGK
SFSRRDHLVRHQRTHTGEKPFMCPTCGKSFSRGYHLIRHQRTHSEKT
Download sequence
Identical sequences G3T252
ENSLAFP00000007221 ENSLAFP00000007221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]