SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T2I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T2I1
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T2I1
Sequence length 430
Comment (tr|G3T2I1|G3T2I1_LOXAF) Small ArfGAP2 {ECO:0000313|Ensembl:ENSLAFP00000007378} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SMAP2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDLAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSEPAPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSVSRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPTF
PGVTPPNSIMGSMMPPPVGMVTQPGASGMVAAPMAMPAGYMGGMQASMMGVPNGMMTTQQ
AGYMAGLAAMPQTMYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMNGGNGQAA
NQTLSPQMWK
Download sequence
Identical sequences G3T2I1
ENSLAFP00000007378 XP_003415575.1.64505 ENSLAFP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]