SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T2J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T2J9
Domain Number 1 Region: 566-1043
Classification Level Classification E-value
Superfamily Ras GEF 1.01e-136
Family Ras GEF 0.000000000000265
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 2.88e-51
Family TBP-associated factors, TAFs 0.0000003
Further Details:      
 
Domain Number 3 Region: 207-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-39
Family DBL homology domain (DH-domain) 0.000000229
Further Details:      
 
Domain Number 4 Region: 417-573
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-37
Family Pleckstrin-homology domain (PH domain) 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T2J9
Sequence length 1330
Comment (tr|G3T2J9|G3T2J9_LOXAF) SOS Ras/Rho guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSLAFP00000007400} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SOS2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEDLIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQED
DIGLVSLCEDEPSSSGELNYYDLVRAEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSD
IEKIFSNISDIHELTVKLLGLIEDAVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILSPKFNEHFSKLMARPAVAVHFQSISDGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDGECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHVFLFDGLMISCKPNHGQSRLP
GYNNAEYRLKEKFVMRKTQVCDKEDTCECKHAFELISKDENSIIFAAKSAEEKNNWMAAL
ISLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKL
AIEKGEQPISADLKRFRKEYIQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSV
RGKSMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQSETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIIEVLQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKGGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRIEPEIRRYFENLNPMGSASEKEFTDYLFNKSLEIEPRNC
KQPTRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELEST
MSAPTSPNTPSTPPVSASSELSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKL
SEEPLVPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPSGAFDGP
LHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPMGHLHRDVRDASTSPNSPNTP
PSTPSPRVPRRCHVLSSNHNNLPHPPAPPVPPRQNSGPHLPKLPPKTYKRELSHPPLYRL
PLLENAETPQ
Download sequence
Identical sequences G3T2J9
ENSLAFP00000007400 ENSLAFP00000007400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]