SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T368 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T368
Domain Number 1 Region: 91-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000134
Family Cripto EGF-like domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 55-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000402
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T368
Sequence length 160
Comment (tr|G3T368|G3T368_LOXAF) Teratocarcinoma-derived growth factor 1 {ECO:0000313|Ensembl:ENSLAFP00000007663} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TDGF1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MECFSSSVIFIMAFSKAFELGLVAGGDADIRSQEEPVVRHQPFQFVPFMGIQDSKELNKT
CCLNGGTCMLGSFCACPPYFYGRNCEHDVRKENCGSVPHDTWLPRKCSMCKCWHGWLRCF
PQTFLPGCDGRVMDEHLEASRTPELLPSVCTTLMLASLCL
Download sequence
Identical sequences G3T368
ENSLAFP00000007663 ENSLAFP00000007663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]