SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T3B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T3B8
Domain Number 1 Region: 215-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000685
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 282-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  G3T3B8
Domain Number - Region: 390-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 338-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 39-95
Classification Level Classification E-value
Superfamily Sialidases 0.00932
Family Sialidases (neuraminidases) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T3B8
Sequence length 460
Comment (tr|G3T3B8|G3T3B8_LOXAF) Netrin G1 {ECO:0000313|Ensembl:ENSLAFP00000007724} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NTNG1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
GNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTI
ELTDNIIITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVL
EIICTEEYSTGYMTNSKIINFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDL
RIRLLRPAIGEIFVDEQHLARYFYAISDIKVQGRCKCNLHATVCVYDNSKLTCECEHNTT
GPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTV
ICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKT
GTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNIRCQCPEAYTGILCEKLRC
EEAGSCGDSSGQGAPREGSPALLLLLLLAAVLGTTSPLAF
Download sequence
Identical sequences G3T3B8
ENSLAFP00000007724 ENSLAFP00000007724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]