SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T3K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T3K3
Domain Number 1 Region: 43-232
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.3e-65
Family Regulator of G-protein signaling, RGS 0.0000000225
Further Details:      
 
Domain Number 2 Region: 395-622
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-59
Family DBL homology domain (DH-domain) 0.000000625
Further Details:      
 
Domain Number 3 Region: 623-757
Classification Level Classification E-value
Superfamily PH domain-like 5.85e-39
Family Pleckstrin-homology domain (PH domain) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T3K3
Sequence length 919
Comment (tr|G3T3K3|G3T3K3_LOXAF) Rho guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSLAFP00000007840} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ARHGEF1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
AEEMARGAAPGPPRPGLVPISIIGAEDEDFENELETNAEEQNSQFQSLEQVKRRPVHLIA
LLQHVALQFEPAPLLCCLHADMLSTLGPKEFKKAFIDFYHSFLDKTAVLRVSVPANVAFE
LDRTRPDLISEDIQRRFVQEVVQSQQAAISRQLEDFRSKRLMGMTPWEQELAHLEAWAGR
DRTTYEARERLTAERLLTHLEEMQPTISTDEEKSAAVVNAISVYMRHLGVRTKSGDKKSG
RNFFRKKVLPNRRPDEPPKTKKGLSSILDAARWNRGEPQVPDFRHLKIEAEADKQGSTER
KGGLAVPSRDRNVGVPGQDTLGVSLHPLSGDSPDREPGVDPPLELGDLPLQGPTNLEPPA
APESTEEGADTESPEPGDEGEPGRLGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVI
SELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPQDELQNIFPSLDELIEVHSLFLDSLMKR
RQDSGYLIEEIGDVLLARFDGAEGTWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVD
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERKKVERAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDK
AVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPPRTSPSSTR
EPLLSSSENSNGGREMPPPDGRMERILSDLLPFCRPGPEGQLAATALQKVLSLKQLLLPV
KEDSGAGPPREGDGVPGGGPLSLSQTQKVQEKLLSLEETVKRLEEMEEEFCRLRLLLSQL
GGLLPSLAAPEDSALTGFS
Download sequence
Identical sequences G3T3K3
ENSLAFP00000007840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]