SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T3T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T3T3
Domain Number 1 Region: 221-491
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.64e-65
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.000000000795
Further Details:      
 
Domain Number 2 Region: 503-577
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000000000118
Family Blood coagulation inhibitor (disintegrin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T3T3
Sequence length 845
Comment (tr|G3T3T3|G3T3T3_LOXAF) ADAM metallopeptidase domain 17 {ECO:0000313|Ensembl:ENSLAFP00000007947} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ADAM17 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MRQCLLFLTSLVSFVLAPRPPDDPGYGSQQRLEKLDYLLSDYDILSLSSIQQHSVRKRDL
QTSTHLETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFSGHVV
GEPDSRVLAHIGDDDVTIRINTDGAEYNIEPLWRFINDTRDKRMLVYKSDDIKNVSRLQS
PKVCGYLKMDNEELLPKGLVDREPPKELVHRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLVSISVIKMSLLSLSLLNTQIELIDRVDDIYRNTSWDNAGFKGYGIQIEQ
IRILKSPEKVKPGEKHYNMEKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQ
DFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADL
VTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKT
IESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDSCCNNDCTLKQGVQCSDRNSPC
CKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNADDDTVCLDLGKCKDGKCIPF
CEREQKLESCACNETDNSCKVCCRDRAGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKC
EKRVQDVIERFWSFIDKLSINTFGKFLADNIVGSVLVFSLVFWIPFSILVHCVDKKLDKQ
YESLSLFHPSNVEMLSSMDSASVRIIKPFPTPQTPGRLQPLQPAPVMPPVAVPPKLDHQR
MDTIQEDPSTDSHIDEDVFEKDPFPNSTAAKSFEDLTDRPVTRSEKASSFKLQRQNRVDS
KETEC
Download sequence
Identical sequences G3T3T3
ENSLAFP00000007947 ENSLAFP00000007947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]