SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T3Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T3Y7
Domain Number 1 Region: 124-206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-16
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T3Y7
Sequence length 1707
Comment (tr|G3T3Y7|G3T3Y7_LOXAF) Collagen type XI alpha 2 chain {ECO:0000313|Ensembl:ENSLAFP00000008016} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=COL11A2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MERCSQCHRLLLLVPLVLGLSTAPACAGKSPDSGWLLRLRLPPPPCALDAATRLALPAHL
TSPTPPSSAFLIALAPALPHASMNVLLELSLGFFQSGADDVSSVYIWGQVRESMCSHHWS
VSGGLSDAMTRWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSARPVLDTHGVIIFGARILD
EEVFEGDVQELVIVPGVQAAYESCEQKELECEGGQRERPQNQQHHRTQRSPKKQPSRLHR
PQNQEPQRQPTESFYYDYEPPYYDEMTTGTTPDYQDLIPGEEEGMLESSPLPPPEEEQTD
LQVPPTADRFLAEELGEGGTDAPEGPYDYAYGYGDDYREETELGPALSAETTHSGAVSEQ
SSSSLLTSEGMLVEGPPGPEGPAGLTGPPGIQGNPGPVGDPGERGPPGRAGLPGSDGAPG
PPGTSLMLPPKFRFGSGGGDKGPVVAAQEAQAQAILQQARLALRGPPGPMGYTGRPGPLG
QPGSPGLKGESGDLGPQGPRGPQGLSGPPGKAGRRGRAGADGARGMPGEPGVKGDRGFDG
LPGLPGEKGHRGETGAQGLAGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGVPG
PPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGTQGLPGPQGAIGPHGEKGPRGKPGLPG
MPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDG
FPGFKGDMGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPPGLMGEKGKLGIPGLPG
YPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKG
TSGGDGPHGPPGERGLPGPQGPSGFPGPKGPPGPPGKDGLPGHPGQRGEVGFQGKTGPPG
PPGVVGPQGAAGESGPMGERGHPGPPGPPGEQGLPGTSGKEGTKGDPGPPGAPGKDGPAG
LRGFPGERGLPGTAGGPGLKGNEGPAGPPGPAGSPGERGAAGSGGPIGPPGRPGPQGPRG
AAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQKGTKGNKG
EHGPPGPPGPIGPVGQPGTAGADGEPGARGPQGHFGAKGDEGTRGFNGPPGPIGLQGLPG
PSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPPGGVGNLGPPGEKGEPGEPGSPG
VQGEPGVKGPRGDRGEKGESGQPGEAGPPGPKGPTGDDGPKGNPGPVGFPGDPGPPGEGG
PRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKRGPAGTPGPEGRQGEKGAKGDPG
AVGAPGKTGAVGPAGPAGKPGPDGLRGLPGSVGQQGRPGATGQAGPPGPVGPPGLPGLQG
DAGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSPGQKGETGIPGASGPIGPGGSPG
LPGPAGPKGAKGASGPAGPKGEKGVQGPPGHPGPPGEVIQPLPIQMPKKTRRSVDGSRLM
QEDEAMPTGGAPGSPRGLEEIFGSLDSLRDEIEQMRRPTGTQDSPARTCQDLKLCHPELP
DGQCAYPQPCTVCNMTIPPASVSLDPDPSLLQFSYVDSEGSPVGVVQLTFLRLLSVSAHQ
DISYPCSGGAQDGLLRLRGANEDDLSPETSPYVKEFRDGCQTQQGRTVLEVRTPVLEQLP
VLDASFSDLGAPPRRGGVLLGPVCFMG
Download sequence
Identical sequences G3T3Y7
ENSLAFP00000008016 ENSLAFP00000008016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]