SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T585 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T585
Domain Number 1 Region: 93-232
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-39
Family C-type lectin domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T585
Sequence length 235
Comment (tr|G3T585|G3T585_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000008580} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MALEITYAEVRFKNESDTSGANSERPAAPKEKTSPQQSNDGFPKKLPASLLILLLLLAIS
SFIAFIIFLQEYSRLLKEKKNSKEVFHEKWICEKTNLNVEGKVCGCCPVNWIISNTSCYF
ISSEAKTWTESEKNCSGMGAHLVVINTKEEQLLITQKLKKSSYYLGLSDPEATHQWQWVD
QSPYSTSVTFWHHGEPDNHTGPCVLINIRDGSWGWDDASCDVPQKSICELMKIYL
Download sequence
Identical sequences G3T585
ENSLAFP00000008580 ENSLAFP00000008580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]