SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T5E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T5E6
Domain Number 1 Region: 36-148
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000552
Further Details:      
 
Domain Number 2 Region: 243-372
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.09e-26
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 419-479
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000128
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T5E6
Sequence length 491
Comment (tr|G3T5E6|G3T5E6_LOXAF) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSLAFP00000008652} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=WAS OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
TMSGGTVGGRPGGHGGPGVQQNIPSTLLRDHENQRLFEMLGRKCWTLATAVVQLYLALPP
GAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRMLWEQELYSQLVYSTPTPFFHTFAG
DDCQAGLNFADEGEAQSFQALVQEKIRKRNQRQSGDRRQLLPTPAPANEERRGGLPPLPP
HPGGDLGGPPAGPPALGLVTVDIQNPDITSSRYRGLPAPGPGPVDKKRSGKKKISKADIG
APSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGG
LEAVRQEMRRQEPLPPPPPPSRGGNQPPRPPTMGGNKGRSGPLPPVPLGGTPPPPTPRGP
PPPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPSSGDGPVAPAPPPALGSGGGLAPGGGR
GALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQA
GDEDEDDEWDD
Download sequence
Identical sequences G3T5E6
ENSLAFP00000008652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]