SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T6I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T6I9
Domain Number 1 Region: 280-414,720-893
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.85e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 9-135
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-29
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 1101-1166
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.14e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 181-250
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000214
Further Details:      
 
Domain Number 5 Region: 117-176
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T6I9
Sequence length 1169
Comment (tr|G3T6I9|G3T6I9_LOXAF) Diacylglycerol kinase {ECO:0000256|RuleBase:RU361128} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=DGKD OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RPVALNTSLYFQTVIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTD
ASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHF
SGMHNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLAS
IGKDIIEDEDGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKE
ALLTKCPLGLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLR
RFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQ
LGVLPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMAYETKLPRQAS
SSTVTEDFSEDSEVQQILVYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGK
AYEKTTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGP
SSMCGSTGERAVGSACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQE
QEGFISGLSESEEKKDLRRDDRVGLLPPFWVVLRFSVFLVSKSPCEKLISKGSLSLGSSA
SLPPQPGSRDTLPALNMKILYPHVRAGMSGSLPGGSVISRLLINADPFNSEPENLECYTE
KCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQK
VLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGS
MQMAVSRVIKLQHHRIAQCRTVKISVLGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTLT
RDRAFESTLKSWEDKQKCELPRPPSFSLHPEVLSEEESTQMSQFGQAAGALIHSIREIAQ
SYQDMEQELAHAVNASSKAMDRVYGKPGTAEGVNCSFVLEMVNNIKALRSETELLLAGKV
ALQLDPPQKERLAAALAEMDLQLRKLADTPWLCQPPEPGDEESVMLDLSKRSRSGKFRLV
TKFKKEKNNKNKAARSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLE
RRDLKDLGVTKVGHMKRILCGIKELSRAA
Download sequence
Identical sequences G3T6I9
ENSLAFP00000019547 ENSLAFP00000009145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]