SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T6Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T6Q6
Domain Number 1 Region: 157-485
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.62e-67
Family Pancreatic carboxypeptidases 0.00000235
Further Details:      
 
Domain Number 2 Region: 24-139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.73e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 485-572
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1e-19
Family Carboxypeptidase regulatory domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T6Q6
Sequence length 598
Comment (tr|G3T6Q6|G3T6Q6_LOXAF) Carboxypeptidase X, M14 family member 2 {ECO:0000313|Ensembl:ENSLAFP00000009231} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CPXM2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RSGLGAYCGLVMYKAGINENDFYDGAWCAGRNDLRQWIEVDARRLTKFTGVITQGRNSLW
LSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQS
WLDNGSICMRMEILGCPLPDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPN
ITRIYNIKSHQGLKLYAVEISDNPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLMQFLCQ
EYLARNERIVHLVDETRIHILPSLNPDGYEKAYEAGSELGGWSLGRWTHEGIDINNNFPD
LNTLLWEAEDRQNVPRRVPNHYIAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQG
GELVVAYPYDMVRSLWKTQEHTPTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKE
DGTVNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKYPHESELPEEWENNRESLIVFME
QVHRGIKGTVRDPHGKGIPNAVISVEGVNHDIRTASDGDYWRLLNPGEYAVTARAEGFTA
STKNCMVGYDMGATQCDFMLSKTNLARIREIMKKFGKQPVSLPARRLKLRGRKRRQRG
Download sequence
Identical sequences G3T6Q6
ENSLAFP00000009231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]