SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T7S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T7S6
Domain Number 1 Region: 530-594,762-1102
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-118
Family Ras GEF 0.0000113
Further Details:      
 
Domain Number 2 Region: 129-352
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-43
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 340-495
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000196
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  G3T7S6
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily PH domain-like 0.00601
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T7S6
Sequence length 1105
Comment (tr|G3T7S6|G3T7S6_LOXAF) Ras protein specific guanine nucleotide releasing factor 2 {ECO:0000313|Ensembl:ENSLAFP00000009677} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RASGRF2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
QYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLTQKYIHLVQIVE
TEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSF
MRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRM
AASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNI
YQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITL
HELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLD
TSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHL
LKAGGVLSLIECTLIEEPDASDDDPKGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQE
KAAWTSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCK
VPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPV
RSLELFFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKI
GALDLTTSSASSSPTTTHSPAASPPPHTAAVLESAPVDRAGMESSPAADAAELSPCRSPS
TPRHLRYRQPGEPGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFIIRR
TATNRVLNVLRHWVSKHAQDFELDNELKMNVLNLLEEVLRDPDLLPQERKATANILRALS
QDDQDDIHLKLEDIIQMTDYLKAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWM
KLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNG
VLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTISSEGRFKSLRETLKNCNPPAVP
YLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYL
LDKTLIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences G3T7S6
ENSLAFP00000009677 ENSLAFP00000024186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]