SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T835 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T835
Domain Number 1 Region: 428-505,540-627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-50
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 221-282
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.8e-18
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 7-52
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000125
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 180-212
Classification Level Classification E-value
Superfamily RING/U-box 0.0000431
Family IBR domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3T835
Sequence length 630
Comment (tr|G3T835|G3T835_LOXAF) Tripartite motif containing 41 {ECO:0000313|Ensembl:ENSLAFP00000009817} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TRIM41 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEEDGDEEEVEAVGAGGGWDTPMRDEDYEGDMEEEVEEEEEGVFWTNGMGGSNWDN
MDYVWEEEDEEEDLDYYLGNMEEDLRGEDEEDEEEVLEEDEEEELDPVTPLPPPPAPRRC
FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPAPGRASRGNEQGICPKHQEALKLFCEV
DEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHLEPLKKHLEAVQKMKAKEERRVT
ELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAAIRLSDQAAQL
SRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEAWSPDPCQPHSHDFLTDAIVRK
MSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQG
FRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGSGGPSVGSGDASSSRHHHRRRRLHLP
QQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH
IHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences G3T835
ENSLAFP00000009817 XP_003404744.1.64505 ENSLAFP00000009817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]