SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T8E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T8E0
Domain Number 1 Region: 564-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-48
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 2 Region: 70-148
Classification Level Classification E-value
Superfamily F-box domain 4.32e-19
Family F-box domain 0.00085
Further Details:      
 
Domain Number 3 Region: 794-903
Classification Level Classification E-value
Superfamily PH domain-like 5.11e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T8E0
Sequence length 905
Comment (tr|G3T8E0|G3T8E0_LOXAF) Epithelial cell transforming 2 like {ECO:0000313|Ensembl:ENSLAFP00000009948} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ECT2L OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRREFLFTIFLRCTKSQLR
FVQDCFSQRMQVAKVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWSWKFLTEQDCLWRP
KCIKFGWFLPYTPTDNEYGAWKHHYIACVSNLDWLTPRESTAVYGTLNEPKVGDEELQER
QREKCLRKLIWEKIGLRKKELFKARPPWVSGTCCSRLLKSKCQPRLSQTVRDRVGLHEAL
EKQLVLASLEALPKRSNVSGSHSYPSLSKKNWRGVFKNYDCSSNAFQLHCILISSRIPAY
EMVVDSVKVDVISVVYEHCGITLEGLLSLIEKALDGRKAQSMGIFSDGDSREINLLQGYK
IGIKNLLRPEVRDFWEKLGSYVATEEEGGHVDLFVPLAASEAGVEVLSQLSQLTGTLFTA
PTGIATGSYQHILSDWLGQQWEKAPPSIYFIESKLQTWSSLMDFLEDTLKSVRRQFSPFS
KELKKNISGRVIGQLMFDMMSTINILNSQEIAQALADGLMELSKENSEGNDVEDNSKDTK
SSLRKNDLNFEVLVKLERKLQMDSAEKRTRVVRELLLSERKYVQMLEIVRDVYVTPMKAA
LSSNRAILSAANIQIIFSDILRILSLNRQFLDNLRDRLQEWGPAHCVGEIFLKFGSQLNT
YTNFFNNYPVVLKTIEKCREMIPAFRAFLKRHDKTIITKMLSLPELLLYPSRRFEEYIHL
LYALRLHTPAEHIDREDLTTAIDQIKQYKGYIDQVKQNINQKDQLSDIQRTIWGCPTLSE
VNRYLIRVQDVAQLHCSDEEIIFSLRRYEHIHDLSLFLFNDALLVSSRGTSHTPFERTSK
TTYRFIASVALHRLLVGDIPDSKYTKNAFILQGPKHGWICATEAEEDKFLWLSVLQNAIK
SSVEK
Download sequence
Identical sequences G3T8E0
ENSLAFP00000009948 ENSLAFP00000009948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]