SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T8I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T8I6
Domain Number 1 Region: 597-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-81
Family Protein kinases, catalytic subunit 0.00000000374
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-69
Family Ephrin receptor ligand binding domain 0.00000182
Further Details:      
 
Domain Number 3 Region: 297-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 903-968
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.42e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  G3T8I6
Domain Number - Region: 227-294,329-349
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000863
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3T8I6
Sequence length 974
Comment (tr|G3T8I6|G3T8I6_LOXAF) EPH receptor A8 {ECO:0000313|Ensembl:ENSLAFP00000010004} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=EPHA8 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
VNLLDTSTIYGDWGWLTYPAHGWESINEVDESFRPIHTYQVCNVMSPNQNNWLRTSWVPR
DGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGARTQESQFLKIDTIAAD
ESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNL
AAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRD
ACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACRCDFSYYRAALDPPSSACTRPPSA
PVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALNHCEACGSSTRFMPQQTS
LVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERA
GQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQ
VRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYS
KAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKVPETQFYAESHTYEEPGRAGRSFTREIE
ASRIHIEKIIGSGESGEVCYGWLRVPGQQDVPVAIKALKPGYTERQRRDFLSEASIMGQF
DHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIMQLVGMLRGVGAGMRYL
SDLGYVHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIA
FRTFSWASDVWSFGVVMWEVLAYGERPYWNMTNHDVISSVEEGYRLPAPMGCPRALHQLM
LDCWHKDRAQRPRFSQIVSVLDALIRSPESLRVTATVNRCPPPAFAQSCFDLRGGGGGGG
GLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTM
RAQLTSTQEPHRHL
Download sequence
Identical sequences G3T8I6
ENSLAFP00000010004 ENSLAFP00000010004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]