SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3T9A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3T9A0
Domain Number 1 Region: 624-864
Classification Level Classification E-value
Superfamily HCP-like 1.13e-32
Family HCP-like 0.0014
Further Details:      
 
Domain Number 2 Region: 836-951
Classification Level Classification E-value
Superfamily HCP-like 0.000000000101
Family HCP-like 0.0099
Further Details:      
 
Domain Number 3 Region: 235-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000087
Family Pentraxin (pentaxin) 0.077
Further Details:      
 
Weak hits

Sequence:  G3T9A0
Domain Number - Region: 519-587
Classification Level Classification E-value
Superfamily HCP-like 0.085
Family HCP-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3T9A0
Sequence length 1083
Comment (tr|G3T9A0|G3T9A0_LOXAF) SEL1L family member 3 {ECO:0000313|Ensembl:ENSLAFP00000010340} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SEL1L3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
FFPFQNFVPSLGRQTSLTTSVIPKAEQSTAYKDFIYFTVFEGNVRNVSKVSVEYLCSQPC
VVSLEAVVSSEFRSSIPVYKKRWKNEKHLHTSRMQIVHVKFPSIMVYRDDYFIRNSISVS
AVILRAWITHKYGGGDSNVKWEENLLHAVATNYTLLKTVPPFERPFKDHQVCLEWNMDYI
WNLQANKIPQCPLENDMVTLLGFPYASSGENTGIVKKFARFRNRELEATRRQRMDYPVFT
VSLWLYLLHYCKASLCGILYFVDSNEMYGTPSVFLTEEGHLHIQMHLIKGEDLAVKTKFI
IPLKEWFRLDISFNGGQIVVTTSIGQDLKSYHNQTISFREDFHYDDTAGYFIIGGSRYVA
GIQGFFGPLKYYRLRTLDPDQIFNPLLEKQLAEQIKLYYERCAEIQEIVSVYASMVQQGG
VRQEACDPWNSYLDLKRRYGSPSTCRAFPWEKELKDKHPSLFQALMEMDLLTVPRNSNEF
ILEIGARIFEKAIKRLSSVDGLHQISSVVPFLMDSSCCGYHKASYYLTVFYETGLNVPQD
QLQGMLYSLIGGQGSERLSSMNLGYKHYQGIDNYHLDSELSYAYYSNIAMKTPLDQHTLQ
GDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKN
PEAAIEWYAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGL
GWYYHKFKKNYAKAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGVTGRNQTLAGEYFHKA
AQGGHIEGTLWCSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGS
WHEALLYYVLAAETGIEVSQTNLAHICEERPDLARRYLAVNCVWRYYNFSVSQIDAPSFA
YLKMGDLYYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIEEGATIPHHILDFLE
IDPTIYSSNFSILRELYERCWSHSNEESFSPCSLAWLYLHLRLVWGTLLHSALIYFLGTF
LLSVLIAWTVQYFQSVSASGSSPTPAQTSPGPAASTSSPAATPAADAWDQGQPTVTNNPE
PRG
Download sequence
Identical sequences G3T9A0
ENSLAFP00000010340 ENSLAFP00000010340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]