SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TC48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TC48
Domain Number 1 Region: 32-484
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.66e-92
Family Integrin alpha N-terminal domain 0.000000000488
Further Details:      
 
Domain Number 2 Region: 790-1005
Classification Level Classification E-value
Superfamily Integrin domains 6.02e-53
Family Integrin domains 0.0000425
Further Details:      
 
Domain Number 3 Region: 486-642
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-44
Family Integrin domains 0.0000105
Further Details:      
 
Domain Number 4 Region: 643-783
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-32
Family Integrin domains 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TC48
Sequence length 1052
Comment (tr|G3TC48|G3TC48_LOXAF) Integrin subunit alpha 5 {ECO:0000313|Ensembl:ENSLAFP00000011603} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGA5 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
AGAMGSRTPGSPLHVVQPRWRPRRQPPGVGGFNLDAEAPAVLSGPSGSFFGFSVEFYRPG
AEGVSVLVGAPKDNTSQPGVLQGGAVYLCPWGASPSQCTPIEFDSKGSRILESSLSSPEG
EEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYA
PCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGKSFLCHPLAPCTQPPIPAP
SPKSPVLPVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTI
LNGSDVRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMERTTDGRAQEVGRV
YVYLQHPAGMDPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGVPFGGETQQGVV
FIFPGGPGGLGSKPSQVLLPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGAFGVDKAV
VYRGRPIVSASASLNIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVPDSIGFTVE
LQLDWQKQKGGVRRALFLASRQASLTQTLIIQNGAREDCREMKIYLRNESEFRDKLSPIH
ITLNFSLNPQASMDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFRTPHS
GEQNHYVYLGDKNSLNLTFHAQNVGEGGAYEAELWVTAPPEAEYSGLVRHPGNFSSLSCE
YSTVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQSDV
VSFRLSVEAQAQVSLNGVSKPETVLFPVSDWHPRDQPQEEGDVGPAVHHVYELINLGPSS
ISQGILELSCPQALEGQQLLYVTRVTGLSNCTTTPPLNPQGLELDPESSEHHRLQRREAP
SRSPASSGPQILKCPEAECFKLRCELGPLHRQESQSLQLHFRVWAKTFLQREHQPFSLQC
EAVFEALKMPYRILPRQLPQKKLQVATAVQWTKAEGSHGVPLWIIILAILLGLLLLGLLI
YVLYKLGFFKRSLPYGTTMEKAQLKPPATSDA
Download sequence
Identical sequences G3TC48
ENSLAFP00000011603 ENSLAFP00000011603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]