SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TC54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TC54
Domain Number 1 Region: 183-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-31
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000806
Family B-box zinc-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TC54
Sequence length 315
Comment (tr|G3TC54|G3TC54_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000011610} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
ESKNLLCLLCSSSQEHEAHRHCSIEYAVEKYRKAFESWRIIELREYKEDEYRDYILVFTG
EAFKTNEVFMGKDPRKSEKSKRGVQNNQPVDELLHREEKQHLEGLKSERKRILQQLKKSQ
TTMVQKQNHLREMFEELLNLCHKPDVDLLQNLEDTLTRSESVQLHMPQPVNPALSARPIT
GLIDRFNQFQVNISLNYEASSHDIMLSDDVRSLIFRHDLQEVPFPSGRSNYFATWGDQAF
SSGKHYWEMHVDSSWDWAIGVCKDTWLRKNCSVIESGDTFLLLCVKGDNGYHLFTTSPVL
SQYIEKPLGKVGVFV
Download sequence
Identical sequences G3TC54
ENSLAFP00000011610 ENSLAFP00000011610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]