SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TC91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TC91
Domain Number 1 Region: 139-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000123
Family EGF-type module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TC91
Sequence length 249
Comment (tr|G3TC91|G3TC91_LOXAF) Amphiregulin {ECO:0000313|Ensembl:ENSLAFP00000011649} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=AREG OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MRTSLRLLPAPVALLLLVILGSGHYVAGSEHKGTYSGKGEQFSEDHSASGLEVMVTSRSE
MSSVSAMPSGGELSSETDYDYSEEYDDEPQISGYIVDDSVKVEQVVKPPHNKTESEQTSS
KPKRKKKAGKNGKNRKNKKKTPCDAEFQNFCIHGECKYIEHLKAISCKCHQDYFGERCGE
KTMKTQRMVDNDLSKIALAAIVAFVSAVSLTAVVVVITNQLRKRYFREYEGESEETKKLR
QENNAHTIV
Download sequence
Identical sequences G3TC91
ENSLAFP00000011649 ENSLAFP00000011649 XP_003414265.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]