SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TCQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TCQ0
Domain Number 1 Region: 124-371
Classification Level Classification E-value
Superfamily vWA-like 4.45e-86
Family Integrin A (or I) domain 0.00000000038
Further Details:      
 
Domain Number 2 Region: 367-457
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-33
Family Integrin domains 0.00000381
Further Details:      
 
Domain Number 3 Region: 623-707
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-23
Family Integrin beta tail domain 0.00000513
Further Details:      
 
Domain Number 4 Region: 20-74
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.0000487
Further Details:      
 
Domain Number 5 Region: 581-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Integrin beta EGF-like domains 0.00034
Further Details:      
 
Domain Number 6 Region: 539-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  G3TCQ0
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 467-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TCQ0
Sequence length 778
Comment (tr|G3TCQ0|G3TCQ0_LOXAF) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGB3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LWAALLALGALAGVGVGGPSICATRGVSSCQQCLAVSPMCAWCSDKALPVGTARCNLKEN
LLKDNCAPESIEFPISEARVLEDRPLSDKGSGDSSQVTQVTPQKIALRLRPDDSKNFSVQ
VRQVEDYPVDIYYLMDLSYSMKDDLWSIQSLGTNLASQMRKLTSNLRIGFGAFVDKPVSP
YMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQNVSRNRDAPEGGF
DAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHIGSDNHYSA
STTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSKDSSNVLQL
IVDAYGKIRSKVELEVRDLPEELSLSFNATCLDNEVIPGLKSCVGLKIGDTVSFSIEAKV
RGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCACQAQAQPHSPRCNNGNGTFECGVCRCE
PGWLGTQCECSEEDYRPSQQDECSPRGGQPLCSQRGECLCGQCVCHSSDFGKITGKYCEC
DDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCEC
GSCVCTQPGSYGDTCEKCPTCPDACTFKKQCVECKKFDRGELHEENTCNRDCRDEIELVK
ELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPDCPKGPDILVVLLSVMGA
ILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKQATSTFTNITYRG
Download sequence
Identical sequences G3TCQ0
ENSLAFP00000011857 ENSLAFP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]